PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14g017760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 300aa    MW: 33637.3 Da    PI: 10.0257
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14g017760.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind362.67.6e-111152991301
       GAGA_bind   1 mdddgsrernkgyyepa.aslkenlglqlmssiaerdaki....rernlalsekkaavaerd....maflqrdkalaernkalverdnkllalll 86 
                     mdddg+  rn+gyyepa a++k nlglqlms+i +r++k+    r+ nl ++++++++++++    m++    +++++       +++k++++l+
  Csa14g017760.1  15 MDDDGF--RNWGYYEPAaATFKGNLGLQLMSTI-DRNTKPflpgRDPNL-MIGPNGSYHPQEppihMSY----NWINQ-------QKDKFFNMLP 94 
                     99**99..9*******999**************.9**************.************5555555....*****.......899******* PP

       GAGA_bind  87 venslasalpvgvqvlsgtksidslqq.lse..pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkv 178
                     v+++     p++ +vl++t+s+ s+q+ l++  +q+e+++v   + e     ++++  +++k+k+++k++  ++++k+kk +k+k++++++++++
  Csa14g017760.1  95 VTTA-----PNYGNVLPETSSAPSMQMnLHHhhHQTEENPVV--KLE----DEVVQ--TNKKRKTNSKAGLATTTTKAKKPRKPKDENSNNNNNN 176
                     9997.....9*****************644423555555554..222....33333..344455556667888999999*******998888888 PP

       GAGA_bind 179 kkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLa 273
                     ++ ++ +r+k  kks+d+v+ngvs+D+s+lPvPvC+CtGa++qCY+WG+GGWqSaCCtt+iS++PLP+stkrrgaRi+grKmSqgafkk+LekLa
  Csa14g017760.1 177 NNTNNVSRVKPAKKSVDMVINGVSMDISGLPVPVCTCTGAPQQCYRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLA 271
                     8888779**************************************************************************************** PP

       GAGA_bind 274 aeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     ++G++++np+DLk+hWA+HGtnkfvtir
  Csa14g017760.1 272 SDGFNFGNPIDLKSHWARHGTNKFVTIR 299
                     ***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.3E-17215299IPR010409GAGA-binding transcriptional activator
PfamPF062173.1E-10015299IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MFIIHLDFCF WIFEMDDDGF RNWGYYEPAA ATFKGNLGLQ LMSTIDRNTK PFLPGRDPNL  60
MIGPNGSYHP QEPPIHMSYN WINQQKDKFF NMLPVTTAPN YGNVLPETSS APSMQMNLHH  120
HHHQTEENPV VKLEDEVVQT NKKRKTNSKA GLATTTTKAK KPRKPKDENS NNNNNNNNTN  180
NVSRVKPAKK SVDMVINGVS MDISGLPVPV CTCTGAPQQC YRWGCGGWQS ACCTTNISMH  240
PLPMSTKRRG ARISGRKMSQ GAFKKVLEKL ASDGFNFGNP IDLKSHWARH GTNKFVTIR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0069170.0AC006917.6 Genomic sequence for Arabidopsis thaliana BAC F10B6 from chromosome I, complete sequence.
GenBankAC0106570.0AC010657.3 Genomic sequence for Arabidopsis thaliana BAC T5E21 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010458978.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like
SwissprotQ9LDE21e-177BPC2_ARATH; Protein BASIC PENTACYSTEINE2
TrEMBLQ2PQR30.0Q2PQR3_9BRAS; GAGA-binding transcriptional activator
STRINGfgenesh2_kg.1__1602__AT1G14685.11e-176(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28932769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-176basic pentacysteine 2